Contents
| User information |
MSAQISDSIEEKRGFFTRWFMSTNHKDIGVLYLFTAGLAGLISVTLTVYMRMELQHPGVQ YMCLEGMRLVADAAAECTPNAHLPlease use only one-letter code amino acids. In particular, avoid numbers or '*', or '.'.
| List of services available |
| various | SignalP | NetOglyc | NetPhos | NetPico | ChloroP | |
| homology modelling | SWISS-MODEL | CPHmodels | ||||
| threading | FRSVR | SAMt98 | ||||
| secondary structure | JPRED | |||||
| transmembrane helices | TMHMM | TopPred | DAS |
| Information about services available |
| Server | SignalP |
| Site (URL) | http://www.cbs.dtu.dk/services/SignalP/ |
| About | The SignalP World Wide Web server predicts the presence and location of signal peptide cleavage sites in amino acid sequences from different organisms: Gram-positive prokaryotes, Gram-negative prokaryotes, and eukaryotes. The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction based on a combination of several artificial neural networks. |
| Options | If you do not check the organism (gram-positive, gram-negative prokaryotes, or eukaryotes), predictions for all three will be returned. |
| Quote | H Nielsen, J Engelbrecht, S Brunak, and G von Heijne: Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites. Protein Engineering 10, 1-6, 1997 |
| Authors | Henrik Nielsen, Soeren Brunak (both CBS Copenhagen), and Gunnar von Heijne (Univ Stockholm, Sweden) |
| Contact | Kristoffer Rapacki (rapacki@cbs.dtu.dk) |
| Server | NetOglyc |
| Site (URL) | http://www.cbs.dtu.dk/services/NetOGlyc/ |
| About | The NetOglyc WWW server produces neural network predictions of mucin type GalNAc O-glycosylation sites in mammalian proteins. |
| Quote |
|
| Authors | Jan Hansen (CBS, Copenhagen, Denmark) |
| Contact | Kristoffer Rapacki (rapacki@cbs.dtu.dk) |
| Server | NetPhos |
| Site (URL) | http://www.cbs.dtu.dk/services/NetPhos |
| About | NetPhos is a neural network-based method for predicting potential phosphorylation sites at serine, threonine or tyrosine residues in protein sequences. |
| Quote | N Blom, S Gammeltoft, and S Brunak: Sequence- and structure-based prediction of eukaryotic protein phosphorylation Sites. J of Molecular Biology, 294, 1351-1362, 1999. |
| Authors | Nikolaj Blom (CBS, Copenhagen, Denmark, nikob@cbs.dtu.dk) |
| Contact | Kristoffer Rapacki (rapacki@cbs.dtu.dk) |
| Server | NetPico |
| Site (URL) | http://www.cbs.dtu.dk/services/NetPicoRNA/ |
| About | The NetPicoRNA World Wide Web server produces neural network predictions of cleavage sites of picornaviral proteases. |
| Quote | N Blom, J Hansen, D Blaas, and S Brunak: Cleavage site analysis in picornaviral polyproteins: Discovering cellular targets by neural networks. Protein Science, 5, 2203-2216, 1996 |
| Authors | Nikolaj Blom (CBS, Copenhagen, Denmark, nikob@cbs.dtu.dk) |
| Contact | Kristoffer Rapacki (rapacki@cbs.dtu.dk) |
| Server | ChloroP |
| Site (URL) | http://www.cbs.dtu.dk/services/ChloroP/ |
| About |
The ChloroP www-server is able to predict two things:
|
| Help |
|
| Quote | O Emanuelsson, H Nielsen, and G von Heijne:ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Science, 8, 978-984, 1999 |
| Authors | Olof Emanuelsson (CBS Copenhagen, Denmark, olof@cbs.dtu.dk) |
| Contact | Kristoffer Rapacki (rapacki@cbs.dtu.dk) |
| Server | JPRED |
| Site (URL) | http://jura.ebi.ac.uk:8888/ |
| About | A consensus method for protein secondary structure prediction. |
| Quote | J A Cuff, and G J Barton: Evaluation and improvement of multiple sequence methods for protein secondary structure prediction. PROTEINS, 34, 508-519, 1999 |
| Authors | James Cuff, and Geoff Barton (EBI Hinxton, England) |
| Contact | James Cuff (james@ebi.ac.uk) |
| Server | TMHMM |
| Site (URL) | http://www.cbs.dtu.dk/services/TMHMM-1.0/ |
| About | Hidden Markov Model predicting the location of transmembrane helices and their topology. (Remark Burkhard Rost: find it to be the most original method for this purpose!) |
| Quote | ELL Sonnhammer, G von Heijne, and A Krogh: A hidden Markov model for predicting transmembrane helices in protein sequences. Proc of the Sixth Intern Conf on Intelligent Systems for Molecular Biology (ISMB98), 175-182, 1998 |
| Authors | Anders Krogh (CBS, Copenhagen, Denmark) |
| Contact | Anders Krogh (krogh@cbs.dtu.dk ) |
| Server | TopPred |
| Site (URL) | http://www.biokemi.su.se/~server/toppred2/ |
| About | Prediction of location and orientation of transmembrane helices through an advanced use of hydrophobicity patterns, and by applying the 'positive-inside' rule. |
| Quote |
|
| Authors | Erik Wallin, and Gunnar von Heijne (Stockholm Univ, Sweden) |
| Contact | Erik Wallin (erikw@biokemi.su.se) |
| Server | DAS |
| Site (URL) | http://www.biokemi.su.se/~server/DAS/ |
| About | Prediction of location of transmembrane helices through an advanced use of hydrophobicity patterns. |
| Quote | M Cserzo, E Wallin, I Simon, G von Heijne, and A Elofsson: Prediction of transmembrane alpha-helices in procariotic membrane proteins: the Dense Alignment Surface method. Protein Engineering, 10, 673-676, 1997 |
| Authors | Miklos Cserzo, Istvan Simon (both Academy of Sciences, Budapest, Hungary), Erik Wallin, Gunnar von Heijne, Arne Elofsson (Stockholm Univ, Sweden) |
| Contact | Miklos Cserzo (miklos@pugh.bip.bham.ac.uk) |
| Server | FRSVR |
| Site (URL) | http://www.doe-mbi.ucla.edu/people/fischer/TEST/getsequence.html |
| About | Prediction-based threading, also incorporating purely sequence-based database searches. |
| Options |
|
| Quote |
|
| Authors | Daniel Fischer (Ben Gurion Univ of the Negev, Israel) |
| Contact | Daniel Fischer (dfischer@cs.bgu.ac.il ) |
| Server | SAMt98 |
| Site (URL) | http://www.cse.ucsc.edu/research/compbio/HMM-apps/model-library-search.html |
| About | A new hidden Markov model method (SAM-T98) for finding remote homologs of protein sequences is described and evaluated. The method begins with a single target sequence and iteratively builds a hidden Markov model (HMM) from the sequence and homologs found using the HMM for database search. SAM-T98 is also used to construct model libraries automatically from sequences in structural databases. |
| Quote | Kevin Karplus, Christian Barrett, and Richard Hughey:Hidden Markov Models for Detecting Remote Protein HomologiesBioinformatics, 14, 846-856, 1998 |
| Authors | Kevin Karplus, Christian Barrett, and Richard Hughey (UCSD, Santa Cruz, USA) |
| Contact | SAM-INFO (sam-info@cse.ucsc.edu) |
| Server | SWISS-MODEL |
| Site (URL) | http://www.expasy.ch/swissmod/SWISS-MODEL.html |
| About | SWISS-MODEL is an Automated Protein Modelling Server running at the GlaxoWellcome Experimental Research in Geneva, Switzerland (click here for more details on how the method works). |
| Quote |
|
| Authors | Manuel Peitsch, , Torsten Schwede, and Nicolas Guex (Glaxo, Geneva, Switzerland) |
| Contact | Nicolas Guex (ng45767@GlaxoWellcome.co.uk) |
| Server | CPHmodels |
| Site (URL) | http://www.cbs.dtu.dk/services/CPHmodels/ |
| About | CPHmodels is a collection of methods and databases developed to predict protein structures. It currently consists of the following tools: Sowhat: A neural network based method to predict contacts between C-alpha atoms from the amino acid sequence. RedHom: A tool to find a subset with low sequence similarity in a database. Databases: Subsets of the Brookhaven Protein Data Bank (PDB) database with low sequence similarity produced using the RedHom tool. |
| Quote | O Lund, K Frimand, J Gorodkin, H Bohr, J Bohr, J Hansen, and S Brunak:Protein distance constraints predicted by neural networks and probability density functions. Protein Engineering, 10, 1241-1248, 1997 |
| Authors | Ole Lund (CBS, Copenhagen, Denmark) |
| Contact | Kristoffer Rapacki (rapacki@cbs.dtu.dk) |
| Formats for submitting sequence or alignment |